PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000136541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 452aa    MW: 49795.8 Da    PI: 8.1223
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000136541genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-16129174147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
    MDP0000136541 129 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 174
                      899*****************************.***********996 PP

2Myb_DNA-binding56.94.9e-18181224146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
    MDP0000136541 181 RRAFTEEEEERLMQAHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 224
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17124175IPR017930Myb domain
SMARTSM007172.9E-14128177IPR001005SANT/Myb domain
PfamPF002499.6E-16129174IPR001005SANT/Myb domain
SuperFamilySSF466894.12E-28129222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-26130182IPR009057Homeodomain-like
CDDcd001673.58E-13132173No hitNo description
PROSITE profilePS5129427.372176230IPR017930Myb domain
SMARTSM007178.9E-15180228IPR001005SANT/Myb domain
PfamPF002491.2E-14181223IPR001005SANT/Myb domain
CDDcd001675.20E-12183223No hitNo description
Gene3DG3DSA:1.10.10.607.0E-21183229IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MMANNGAIYA TETPNTLSCF SSSSSSSSSS SSMGMVYADM GSLSLSSKFG VYSSVSSQDS  60
SYISKISEPE NGRAFWGFPS TRSYEDHHNS SDMKGSDYIS SDHDKNPNES GGKVSEKETE  120
SGQSKLCARG HWRPAEDSKL KELVALYGPQ NWNLIAEKLE GRSGKSCRLR WFNQLDPRIN  180
RRAFTEEEEE RLMQAHRIYG NKWAMIARLF PGRTDNAVKN HWHVIMARKY REQSSAYRRR  240
KLNQTVYRSM EENPSFNAAS RSTEPPPPYN GLSLPNGGLG GSGSISSFSY GTSYDGVVGY  300
GADYYGSNGS QNLISVEEEA IARKKLLSYN NSGFCSQQTP EFFRGRKSNE VMGMMSQNQC  360
WDGSGEMEGH SYGGMYTHHP PPNMNVMTMQ QSNFHSLVHQ KYSDSSCQFS GGKPSPSASA  420
ADRVVGSGGG SSRRETSIQP PPFIDFLGVG AT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-341292297107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.156700.0bud| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350925.10.0PREDICTED: myb-related protein Hv33-like
RefseqXP_008389457.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLD9ZJ600.0D9ZJ60_MALDO; MYB domain class transcription factor
STRINGVIT_01s0026g02600.t011e-149(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-78myb domain protein 105